PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G266800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WRKY
Protein Properties Length: 639aa    MW: 68487.2 Da    PI: 7.32
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G266800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.55e-32273329259
                         --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         +DgynWrKYGqK+vk+s++prsYY+C++++Cpvkkkver++ d++++ei+Y+g+Hnh+
  Brast03G266800.1.p 273 EDGYNWRKYGQKQVKNSDHPRSYYKCSHPNCPVKKKVERCQ-DGHITEIVYKGSHNHP 329
                         8****************************************.***************7 PP

2WRKY105.23.5e-33445503159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         ldDgy+WrKYGqK+vkg+++prsYYrCt++gC+v+k+ver+++dpk v++ Yeg+H+he
  Brast03G266800.1.p 445 LDDGYRWRKYGQKVVKGNPNPRSYYRCTHPGCSVRKHVERASNDPKSVITAYEGKHDHE 503
                         59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.917267331IPR003657WRKY domain
SuperFamilySSF1182902.22E-26269331IPR003657WRKY domain
SMARTSM007745.3E-36272330IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.4E-29272331IPR003657WRKY domain
PfamPF031065.8E-25273329IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-36430505IPR003657WRKY domain
SuperFamilySSF1182906.28E-29437505IPR003657WRKY domain
PROSITE profilePS5081136.873440505IPR003657WRKY domain
SMARTSM007746.6E-38445504IPR003657WRKY domain
PfamPF031061.7E-25446502IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 639 aa     Download sequence    Send to blast
MAGTGKHGAV KEDWMPPTPS PRTLMLSLFN DDVSSRPFSN LPGDNKHQDG IDGSKHSFAD  60
SSSEETTQVA EAHPHFEPKL FAAKEKSVSG SSLAERMAPG NGFCALQIDT SRVGSSASIR  120
SPVVIPPGVS PRELLESPVF LPNAIAHPSP TTGKLPFLMR ANANLAVPSV HKKDEDLSSR  180
DGCTIFFQPI LRPKPPIFPT MDKPSAGDNR QDLSLQSSST ATKDVSGTTS VKPKKSDSML  240
DNDHPIHIPE NEQEECDADR DGNYSLAPVI AAEDGYNWRK YGQKQVKNSD HPRSYYKCSH  300
PNCPVKKKVE RCQDGHITEI VYKGSHNHPL PPPSHHYQDV HGDLGTKLSA SPNTGDQLAD  360
ISAAETREAV DISPVLSNED DNKGTHGTFS LGFDGDGDVT GSKRRKMDSV TSTTGIGTID  420
IEVMASRAVR EPRVIVQTTS DVDILDDGYR WRKYGQKVVK GNPNPRSYYR CTHPGCSVRK  480
HVERASNDPK SVITAYEGKH DHEVPATRNS GHPSSGPGGA PPAPPQANVL HRSPEPAQGG  540
LSQPGGIAAY GSTGRSGVAD AFSSGMLPHG IAVPAPPLGT FARSQIAGHP PAMQGYARRM  600
PPTGEEKVNA AAQHVKPATN TTTAYQQLMG RLSQDPQM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-36262506778Probable WRKY transcription factor 4
2lex_A3e-36262506778Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235260.10.0PREDICTED: probable WRKY transcription factor 2
TrEMBLA0A0Q3QAW10.0A0A0Q3QAW1_BRADI; Uncharacterized protein
STRINGSi013374m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP207538100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-78WRKY family protein